SCOPe 2.06: Domain d1s94b_: 1s94 B:

Lineage for d1s94b_ (1s94 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.2: t-snare proteins [47661] (1 family)

5. Family a.47.2.1: t-snare proteins [47662] (6 proteins)

6. Protein Syntaxin 1A N-terminal domain [47663] (2 species)

7. Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [101222] (1 PDB entry)

8. Domain d1s94b_: 1s94 B: [98739]
   three-helical fragment; similar to one spectrin repeat

Details for d1s94b_

PDB Entry: 1s94, 3.34 Å

PDB Description: crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei

PDB Compounds: (B:) s-syntaxin

SCOPe Domain Sequences for d1s94b_:

Sequence, based on SEQRES records:

>d1s94b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
fmeeffeqveeiramidkisdnvdavkkkhsdilsapqtddqmkeeleelmtdikrtank
vrgklktielnieqeehsnkssadlrirktqystisrkfvevmsdynttqidyrdrckar
ikrqm

Sequence, based on observed residues (ATOM records):

>d1s94b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
fmeeffeqveeiramidkisdnvdavkkkhsdilsapqtddqmkeeleelmtdikrtank
vrgklktielnieqsadlrirktqystisrkfvevmsdynttqidyrdrckarikrqm

Timeline for d1s94b_:

• d1s94b_ first appeared in SCOP 1.67
  
• d1s94b_ appears in SCOPe 2.05
  
• d1s94b_ appears in SCOPe 2.07
  
• d1s94b_ appears in the current release, SCOPe 2.08