![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.2: t-snare proteins [47661] (1 family) ![]() |
![]() | Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
![]() | Protein Syntaxin 1A N-terminal domain [47663] (2 species) |
![]() | Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [101222] (1 PDB entry) |
![]() | Domain d1s94b_: 1s94 B: [98739] three-helical fragment; similar to one spectrin repeat missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1s94 (more details), 3.34 Å
SCOPe Domain Sequences for d1s94b_:
Sequence, based on SEQRES records: (download)
>d1s94b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Longfin inshore squid (Loligo pealei) [TaxId: 6621]} fmeeffeqveeiramidkisdnvdavkkkhsdilsapqtddqmkeeleelmtdikrtank vrgklktielnieqeehsnkssadlrirktqystisrkfvevmsdynttqidyrdrckar ikrqm
>d1s94b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Longfin inshore squid (Loligo pealei) [TaxId: 6621]} fmeeffeqveeiramidkisdnvdavkkkhsdilsapqtddqmkeeleelmtdikrtank vrgklktielnieqsadlrirktqystisrkfvevmsdynttqidyrdrckarikrqm
Timeline for d1s94b_: