Lineage for d1s8ia_ (1s8i A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649269Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries)
  8. 649270Domain d1s8ia_: 1s8i A: [98735]
    complexed with so4

Details for d1s8ia_

PDB Entry: 1s8i (more details), 1.61 Å

PDB Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, second fatty acid free form
PDB Compounds: (A:) Phospholipase A2 homolog

SCOP Domain Sequences for d1s8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8ia_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId: 37195]}
sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
c

SCOP Domain Coordinates for d1s8ia_:

Click to download the PDB-style file with coordinates for d1s8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1s8ia_: