SCOPe 2.05: Domain d1s8ha_: 1s8h A:

Lineage for d1s8ha_ (1s8h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries)

8. Domain d1s8ha_: 1s8h A: [98734]
   complexed with so4

Details for d1s8ha_

PDB Entry: 1s8h, 1.8 Å

PDB Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, first fatty acid free form

PDB Compounds: (A:) Phospholipase A2 homolog

SCOPe Domain Sequences for d1s8ha_:

Sequence; same for both SEQRES and ATOM records:

>d1s8ha_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId: 37195]}
sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
c

Timeline for d1s8ha_:

• d1s8ha_ first appeared in SCOP 1.67
  
• d1s8ha_ appears in SCOPe 2.04
  
• d1s8ha_ appears in SCOPe 2.06
  
• d1s8ha_ appears in the current release, SCOPe 2.08