Class a: All alpha proteins [46456] (286 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (36 species) |
Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries) |
Domain d1s8ga_: 1s8g A: [98733] complexed with dao, gol, so4 |
PDB Entry: 1s8g (more details), 2.3 Å
SCOPe Domain Sequences for d1s8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s8ga_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId: 37195]} sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet c
Timeline for d1s8ga_: