Lineage for d1s8ga_ (1s8g A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750360Protein Snake phospholipase A2 [48624] (36 species)
  7. 1750403Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries)
  8. 1750406Domain d1s8ga_: 1s8g A: [98733]
    complexed with dao, gol, so4

Details for d1s8ga_

PDB Entry: 1s8g (more details), 2.3 Å

PDB Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, fatty acid bound form
PDB Compounds: (A:) Phospholipase A2 homolog

SCOPe Domain Sequences for d1s8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8ga_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId: 37195]}
sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
c

SCOPe Domain Coordinates for d1s8ga_:

Click to download the PDB-style file with coordinates for d1s8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1s8ga_: