Lineage for d1s8ga_ (1s8g A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361311Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries)
  8. 361314Domain d1s8ga_: 1s8g A: [98733]
    complexed with gol, lau, so4

Details for d1s8ga_

PDB Entry: 1s8g (more details), 2.3 Å

PDB Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, fatty acid bound form

SCOP Domain Sequences for d1s8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8ga_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus)}
sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
c

SCOP Domain Coordinates for d1s8ga_:

Click to download the PDB-style file with coordinates for d1s8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1s8ga_: