Lineage for d1s8ga_ (1s8g A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein Snake phospholipase A2 [48624] (38 species)
  7. Species Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId:37195] [101483] (3 PDB entries)
  8. Domain d1s8ga_: 1s8g A: [98733]
    complexed with dao, gol, so4

Details for d1s8ga_

PDB Entry: 1s8g (more details), 2.3 Å

PDB Description: Crystal structure of Lys49-Phospholipase A2 from Agkistrodon contortrix laticinctus, fatty acid bound form
PDB Compounds: (A:) Phospholipase A2 homolog

SCOPe Domain Sequences for d1s8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8ga_ a.133.1.2 (A:) Snake phospholipase A2 {Broad-banded copperhead (Agkistrodon contortrix laticinctus) [TaxId: 37195]}
sllelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfkfkckkpet
c

SCOPe Domain Coordinates for d1s8ga_ are not available.

Timeline for d1s8ga_: