SCOPe 2.05: Domain d1s8ad_: 1s8a D:

Lineage for d1s8ad_ (1s8a D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)
   contains a common phosphate-binding site

5. Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)

6. Protein Methylglyoxal synthase, MgsA [52340] (3 species)

7. Species Escherichia coli [TaxId:562] [52341] (5 PDB entries)

8. Domain d1s8ad_: 1s8a D: [98730]
   complexed with pga; mutant

Details for d1s8ad_

PDB Entry: 1s8a, 2.2 Å

PDB Description: h98q mutant of methylglyoxal synthase from e. coli complexed with phosphoglycolic acid

PDB Compounds: (D:) methylglyoxal synthase

SCOPe Domain Sequences for d1s8ad_:

Sequence; same for both SEQRES and ATOM records:

>d1s8ad_ c.24.1.2 (D:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavpqdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

Timeline for d1s8ad_:

• d1s8ad_ first appeared in SCOP 1.67
  
• d1s8ad_ appears in SCOPe 2.04
  
• d1s8ad_ appears in SCOPe 2.06
  
• d1s8ad_ appears in the current release, SCOPe 2.08