Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries) Uniprot P00761 9-231 ! Uniprot P00761 |
Domain d1s83a_: 1s83 A: [98718] complexed with 4ha, ca, mg, so4 |
PDB Entry: 1s83 (more details), 1.25 Å
SCOPe Domain Sequences for d1s83a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s83a_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d1s83a_: