Lineage for d1s7za_ (1s7z A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348592Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2348629Superfamily a.159.3: B-form DNA mimic Ocr [101059] (1 family) (S)
    automatically mapped to Pfam PF08684
  5. 2348630Family a.159.3.1: B-form DNA mimic Ocr [101060] (1 protein)
  6. 2348631Protein B-form DNA mimic Ocr [101061] (1 species)
    Gene 0.3 protein; active form is a dimer
  7. 2348632Species Bacteriophage T7 [TaxId:10760] [101062] (1 PDB entry)
  8. 2348633Domain d1s7za_: 1s7z A: [98715]
    complexed with cs

Details for d1s7za_

PDB Entry: 1s7z (more details), 1.83 Å

PDB Description: Structure of Ocr from Bacteriophage T7
PDB Compounds: (A:) Gene 0.3 protein

SCOPe Domain Sequences for d1s7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7za_ a.159.3.1 (A:) B-form DNA mimic Ocr {Bacteriophage T7 [TaxId: 10760]}
mtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmasegidle
fedsglmpdtkdvirilqariyeqltidlwedaedllneyleevee

SCOPe Domain Coordinates for d1s7za_:

Click to download the PDB-style file with coordinates for d1s7za_.
(The format of our PDB-style files is described here.)

Timeline for d1s7za_: