![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
![]() | Superfamily a.159.3: B-form DNA mimic Ocr [101059] (1 family) ![]() automatically mapped to Pfam PF08684 |
![]() | Family a.159.3.1: B-form DNA mimic Ocr [101060] (1 protein) |
![]() | Protein B-form DNA mimic Ocr [101061] (1 species) Gene 0.3 protein; active form is a dimer |
![]() | Species Bacteriophage T7 [TaxId:10760] [101062] (1 PDB entry) |
![]() | Domain d1s7za_: 1s7z A: [98715] complexed with cs |
PDB Entry: 1s7z (more details), 1.83 Å
SCOPe Domain Sequences for d1s7za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7za_ a.159.3.1 (A:) B-form DNA mimic Ocr {Bacteriophage T7 [TaxId: 10760]} mtynnvfdhayemlkeniryddirdtddlhdaihmaadnavphyyadifsvmasegidle fedsglmpdtkdvirilqariyeqltidlwedaedllneyleevee
Timeline for d1s7za_: