Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) |
Domain d1s7xj2: 1s7x J:1-181 [98713] Other proteins in same PDB: d1s7xa1, d1s7xb_, d1s7xd1, d1s7xe_, d1s7xg1, d1s7xh_, d1s7xj1, d1s7xk_ |
PDB Entry: 1s7x (more details), 2.41 Å
SCOPe Domain Sequences for d1s7xj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7xj2 d.19.1.1 (J:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d1s7xj2: