SCOP 1.73: Domain d1s7xd2: 1s7x D:1-181

Lineage for d1s7xd2 (1s7x D:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)

8. Domain d1s7xd2: 1s7x D:1-181 [98707]
   Other proteins in same PDB: d1s7xa1, d1s7xb_, d1s7xd1, d1s7xe_, d1s7xg1, d1s7xh_, d1s7xj1, d1s7xk_

Details for d1s7xd2

PDB Entry: 1s7x, 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1s7xd2:

Sequence; same for both SEQRES and ATOM records:

>d1s7xd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1s7xd2:

• d1s7xd2 first appeared in SCOP 1.67
  
• d1s7xd2 appears in SCOP 1.71
  
• d1s7xd2 appears in SCOP 1.75
  
• d1s7xd2 appears in the current release, SCOPe 2.08