Lineage for d1s7xd2 (1s7x D:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938043Domain d1s7xd2: 1s7x D:1-181 [98707]
    Other proteins in same PDB: d1s7xa1, d1s7xb_, d1s7xd1, d1s7xe_, d1s7xg1, d1s7xh_, d1s7xj1, d1s7xk_

Details for d1s7xd2

PDB Entry: 1s7x (more details), 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1s7xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7xd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1s7xd2:

Click to download the PDB-style file with coordinates for d1s7xd2.
(The format of our PDB-style files is described here.)

Timeline for d1s7xd2: