Lineage for d1s7wh_ (1s7w H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025828Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
    Uniprot P01887
  8. 2025939Domain d1s7wh_: 1s7w H: [98699]
    Other proteins in same PDB: d1s7wa1, d1s7wa2, d1s7wd1, d1s7wd2, d1s7wg1, d1s7wg2, d1s7wj1, d1s7wj2

Details for d1s7wh_

PDB Entry: 1s7w (more details), 2.4 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (H:) Beta-2-microglobulin

SCOPe Domain Sequences for d1s7wh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7wh_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1s7wh_:

Click to download the PDB-style file with coordinates for d1s7wh_.
(The format of our PDB-style files is described here.)

Timeline for d1s7wh_: