![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (6 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries) Uniprot P01887 |
![]() | Domain d1s7we_: 1s7w E: [98696] Other proteins in same PDB: d1s7wa1, d1s7wa2, d1s7wd1, d1s7wd2, d1s7wg1, d1s7wg2, d1s7wj1, d1s7wj2 |
PDB Entry: 1s7w (more details), 2.4 Å
SCOPe Domain Sequences for d1s7we_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7we_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1s7we_: