Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries) |
Domain d1s7wb_: 1s7w B: [98693] Other proteins in same PDB: d1s7wa1, d1s7wa2, d1s7wd1, d1s7wd2, d1s7wg1, d1s7wg2, d1s7wj1, d1s7wj2 |
PDB Entry: 1s7w (more details), 2.4 Å
SCOP Domain Sequences for d1s7wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7wb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrd
Timeline for d1s7wb_: