Lineage for d1s7wa1 (1s7w A:182-276)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784691Domain d1s7wa1: 1s7w A:182-276 [98691]
    Other proteins in same PDB: d1s7wa2, d1s7wb_, d1s7wd2, d1s7we_, d1s7wg2, d1s7wh_, d1s7wj2, d1s7wk_

Details for d1s7wa1

PDB Entry: 1s7w (more details), 2.4 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1s7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7wa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOP Domain Coordinates for d1s7wa1:

Click to download the PDB-style file with coordinates for d1s7wa1.
(The format of our PDB-style files is described here.)

Timeline for d1s7wa1: