Lineage for d1s7ve_ (1s7v E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548484Domain d1s7ve_: 1s7v E: [98690]
    Other proteins in same PDB: d1s7va1, d1s7va2, d1s7vd1, d1s7vd2
    mutant

Details for d1s7ve_

PDB Entry: 1s7v (more details), 2.2 Å

PDB Description: Crystal structures of the murine class I major histocompatibility complex H-2Db in complex with LCMV-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ve_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1s7ve_:

Click to download the PDB-style file with coordinates for d1s7ve_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ve_: