SCOP 1.67: Domain d1s7ve_: 1s7v E:

Lineage for d1s7ve_ (1s7v E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)

8. Domain d1s7ve_: 1s7v E: [98690]
   Other proteins in same PDB: d1s7va1, d1s7va2, d1s7vd1, d1s7vd2
   mutant

Details for d1s7ve_

PDB Entry: 1s7v, 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ve_:

Sequence; same for both SEQRES and ATOM records:

>d1s7ve_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1s7ve_:

• d1s7ve_ is new in SCOP 1.67
  
• d1s7ve_ appears in SCOP 1.69
  
• d1s7ve_ appears in the current release, SCOPe 2.08