Lineage for d1s7ve_ (1s7v E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746506Domain d1s7ve_: 1s7v E: [98690]
    Other proteins in same PDB: d1s7va1, d1s7va2, d1s7vd1, d1s7vd2

Details for d1s7ve_

PDB Entry: 1s7v (more details), 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1s7ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ve_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1s7ve_:

Click to download the PDB-style file with coordinates for d1s7ve_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ve_: