Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries) |
Domain d1s7vd2: 1s7v D:1-181 [98689] Other proteins in same PDB: d1s7va1, d1s7vb_, d1s7vd1, d1s7ve_ mutant |
PDB Entry: 1s7v (more details), 2.2 Å
SCOP Domain Sequences for d1s7vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7vd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d1s7vd2:
View in 3D Domains from other chains: (mouse over for more information) d1s7va1, d1s7va2, d1s7vb_, d1s7ve_ |