Lineage for d1s7vd2 (1s7v D:1-181)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409372Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)
  7. 409478Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 409488Domain d1s7vd2: 1s7v D:1-181 [98689]
    Other proteins in same PDB: d1s7va1, d1s7vb_, d1s7vd1, d1s7ve_
    mutant

Details for d1s7vd2

PDB Entry: 1s7v (more details), 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7vd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1s7vd2:

Click to download the PDB-style file with coordinates for d1s7vd2.
(The format of our PDB-style files is described here.)

Timeline for d1s7vd2: