SCOP 1.67: Domain d1s7vd1: 1s7v D:182-276

Lineage for d1s7vd1 (1s7v D:182-276)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d1s7vd1: 1s7v D:182-276 [98688]
   Other proteins in same PDB: d1s7va2, d1s7vb_, d1s7vd2, d1s7ve_
   mutant

Details for d1s7vd1

PDB Entry: 1s7v, 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7vd1:

Sequence; same for both SEQRES and ATOM records:

>d1s7vd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1s7vd1:

• d1s7vd1 is new in SCOP 1.67
  
• d1s7vd1 appears in SCOP 1.69
  
• d1s7vd1 appears in the current release, SCOPe 2.08