SCOPe 2.08: Domain d1s7vb_: 1s7v B:

Lineage for d1s7vb_ (1s7v B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1s7vb_: 1s7v B: [98687]
   Other proteins in same PDB: d1s7va1, d1s7va2, d1s7vd1, d1s7vd2

Details for d1s7vb_

PDB Entry: 1s7v, 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1s7vb_:

Sequence; same for both SEQRES and ATOM records:

>d1s7vb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1s7vb_:

• d1s7vb_ first appeared in SCOP 1.67
  
• d1s7vb_ appears in SCOPe 2.07