SCOP 1.67: Domain d1s7va2: 1s7v A:1-181

Lineage for d1s7va2 (1s7v A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)

8. Domain d1s7va2: 1s7v A:1-181 [98686]
   Other proteins in same PDB: d1s7va1, d1s7vb_, d1s7vd1, d1s7ve_

Details for d1s7va2

PDB Entry: 1s7v, 2.2 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7va2:

Sequence; same for both SEQRES and ATOM records:

>d1s7va2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1s7va2:

• d1s7va2 is new in SCOP 1.67
  
• d1s7va2 appears in SCOP 1.69
  
• d1s7va2 appears in the current release, SCOPe 2.08