SCOP 1.73: Domain d1s7uj1: 1s7u J:182-274

Lineage for d1s7uj1 (1s7u J:182-274)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Class I MHC, alpha-3 domain [88604] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
Domain d1s7uj1: 1s7u J:182-274 [98682]
Other proteins in same PDB: d1s7ua2, d1s7ub_, d1s7ud2, d1s7ue_, d1s7ug2, d1s7uh_, d1s7uj2, d1s7uk_

Details for d1s7uj1

PDB Entry: 1s7u (more details), 2.2 Å

PDB Description: Crystal structures of the murine class I major histocompatibility complex H-2Db in complex with LCMV-derived gp33 index peptide and three of its escape variants

PDB Compounds: (J:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1s7uj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7uj1 b.1.1.2 (J:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d1s7uj1:

Click to download the PDB-style file with coordinates for d1s7uj1.
(The format of our PDB-style files is described here.)

Timeline for d1s7uj1: