Lineage for d1s7uh_ (1s7u H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932455Domain d1s7uh_: 1s7u H: [98681]
    Other proteins in same PDB: d1s7ua1, d1s7ua2, d1s7ud1, d1s7ud2, d1s7ug1, d1s7ug2, d1s7uj1, d1s7uj2

Details for d1s7uh_

PDB Entry: 1s7u (more details), 2.2 Å

PDB Description: Crystal structures of the murine class I major histocompatibility complex H-2Db in complex with LCMV-derived gp33 index peptide and three of its escape variants
PDB Compounds: (H:) Beta-2-microglobulin

SCOPe Domain Sequences for d1s7uh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7uh_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1s7uh_:

Click to download the PDB-style file with coordinates for d1s7uh_.
(The format of our PDB-style files is described here.)

Timeline for d1s7uh_: