![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries) |
![]() | Domain d1s7ug2: 1s7u G:1-181 [98680] Other proteins in same PDB: d1s7ua1, d1s7ub_, d1s7ud1, d1s7ue_, d1s7ug1, d1s7uh_, d1s7uj1, d1s7uk_ |
PDB Entry: 1s7u (more details), 2.2 Å
SCOP Domain Sequences for d1s7ug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ug2 d.19.1.1 (G:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d1s7ug2: