Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries) |
Domain d1s7ug2: 1s7u G:1-181 [98680] Other proteins in same PDB: d1s7ua1, d1s7ub_, d1s7ud1, d1s7ue_, d1s7ug1, d1s7uh_, d1s7uj1, d1s7uk_ |
PDB Entry: 1s7u (more details), 2.2 Å
SCOP Domain Sequences for d1s7ug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ug2 d.19.1.1 (G:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d1s7ug2: