Lineage for d1s7ua2 (1s7u A:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501256Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 501260Domain d1s7ua2: 1s7u A:1-181 [98674]
    Other proteins in same PDB: d1s7ua1, d1s7ub_, d1s7ud1, d1s7ue_, d1s7ug1, d1s7uh_, d1s7uj1, d1s7uk_

Details for d1s7ua2

PDB Entry: 1s7u (more details), 2.2 Å

PDB Description: Crystal structures of the murine class I major histocompatibility complex H-2Db in complex with LCMV-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1s7ua2:

Click to download the PDB-style file with coordinates for d1s7ua2.
(The format of our PDB-style files is described here.)

Timeline for d1s7ua2: