![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d1s7ua1: 1s7u A:182-276 [98673] Other proteins in same PDB: d1s7ua2, d1s7ub_, d1s7ud2, d1s7ue_, d1s7ug2, d1s7uh_, d1s7uj2, d1s7uk_ |
PDB Entry: 1s7u (more details), 2.2 Å
SCOPe Domain Sequences for d1s7ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ua1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwep
Timeline for d1s7ua1: