| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries) Uniprot P01887 |
| Domain d1s7tb_: 1s7t B: [98669] Other proteins in same PDB: d1s7ta1, d1s7ta2, d1s7td1, d1s7td2 |
PDB Entry: 1s7t (more details), 2.3 Å
SCOPe Domain Sequences for d1s7tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7tb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1s7tb_: