SCOP 1.73: Domain d1s7ta2: 1s7t A:1-181

Lineage for d1s7ta2 (1s7t A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)

8. Domain d1s7ta2: 1s7t A:1-181 [98668]
   Other proteins in same PDB: d1s7ta1, d1s7tb_, d1s7td1, d1s7te_

Details for d1s7ta2

PDB Entry: 1s7t, 2.3 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1s7ta2:

Sequence; same for both SEQRES and ATOM records:

>d1s7ta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1s7ta2:

• d1s7ta2 first appeared in SCOP 1.67
  
• d1s7ta2 appears in SCOP 1.71
  
• d1s7ta2 appears in SCOP 1.75
  
• d1s7ta2 appears in the current release, SCOPe 2.08