Lineage for d1s7sa1 (1s7s A:182-276)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364706Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)
  8. 364718Domain d1s7sa1: 1s7s A:182-276 [98664]
    Other proteins in same PDB: d1s7sa2, d1s7sb_
    mutant

Details for d1s7sa1

PDB Entry: 1s7s (more details), 1.99 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7sa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

SCOP Domain Coordinates for d1s7sa1:

Click to download the PDB-style file with coordinates for d1s7sa1.
(The format of our PDB-style files is described here.)

Timeline for d1s7sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s7sa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1s7sb_