SCOPe 2.07: Domain d1s7ra2: 1s7r A:1-181

Lineage for d1s7ra2 (1s7r A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
   Uniprot P01901 22-299

8. Domain d1s7ra2: 1s7r A:1-181 [98659]
   Other proteins in same PDB: d1s7ra1, d1s7rb_, d1s7rd1, d1s7re_

Details for d1s7ra2

PDB Entry: 1s7r, 2.95 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1s7ra2:

Sequence; same for both SEQRES and ATOM records:

>d1s7ra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1s7ra2:

• d1s7ra2 first appeared in SCOP 1.67
  
• d1s7ra2 appears in SCOPe 2.06
  
• d1s7ra2 appears in the current release, SCOPe 2.08