Lineage for d1s7ra2 (1s7r A:1-181)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409372Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)
  7. 409523Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)
  8. 409554Domain d1s7ra2: 1s7r A:1-181 [98659]
    Other proteins in same PDB: d1s7ra1, d1s7rb_, d1s7rd1, d1s7re_

Details for d1s7ra2

PDB Entry: 1s7r (more details), 2.95 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1s7ra2:

Click to download the PDB-style file with coordinates for d1s7ra2.
(The format of our PDB-style files is described here.)

Timeline for d1s7ra2: