| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries) |
| Domain d1s7ra1: 1s7r A:182-276 [98658] Other proteins in same PDB: d1s7ra2, d1s7rb_, d1s7rd2, d1s7re_ |
PDB Entry: 1s7r (more details), 2.95 Å
SCOP Domain Sequences for d1s7ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ra1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep
Timeline for d1s7ra1:
View in 3DDomains from other chains: (mouse over for more information) d1s7rb_, d1s7rd1, d1s7rd2, d1s7re_ |