Lineage for d1s7ra1 (1s7r A:182-276)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452843Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 452944Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)
  8. 453019Domain d1s7ra1: 1s7r A:182-276 [98658]
    Other proteins in same PDB: d1s7ra2, d1s7rb_, d1s7rd2, d1s7re_

Details for d1s7ra1

PDB Entry: 1s7r (more details), 2.95 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2kb in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ra1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwep

SCOP Domain Coordinates for d1s7ra1:

Click to download the PDB-style file with coordinates for d1s7ra1.
(The format of our PDB-style files is described here.)

Timeline for d1s7ra1: