SCOPe 2.08: Domain d1s7md_: 1s7m D:

Lineage for d1s7md_ (1s7m D:)

1. Root: SCOPe 2.08
2. Class b: All beta proteins [48724] (180 folds)
3. Fold b.144: Trimeric adhesin [101998] (1 superfamily)
   trimer; contains two different beta-prism-like domains connected by an linker subdomain of less regular structure
4. Superfamily b.144.1: Trimeric adhesin [101999] (1 family)
5. Family b.144.1.1: Trimeric adhesin [102000] (1 protein)
6. Protein Autotransporter Hia [102001] (1 species)
7. Species Haemophilus influenzae [TaxId:727] [102002] (1 PDB entry)
8. Domain d1s7md_: 1s7m D: [98652]

Details for d1s7md_

PDB Entry: 1s7m, 2.1 Å

PDB Description: Crystal Structure of HiaBD1

PDB Compounds: (D:) Hia

SCOPe Domain Sequences for d1s7md_:

Sequence; same for both SEQRES and ATOM records:

>d1s7md_ b.144.1.1 (D:) Autotransporter Hia {Haemophilus influenzae [TaxId: 727]}
akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
yhdqvrnanevkfksgnginvsgktvngrreitfelak

SCOPe Domain Coordinates for d1s7md_ are not available.

Timeline for d1s7md_:

• d1s7md_ first appeared in SCOP 1.67
  
• d1s7md_ appears in SCOPe 2.07