Lineage for d1s7mb_ (1s7m B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383621Fold b.144: Trimeric adhesin [101998] (1 superfamily)
    trimer; contains two different beta-prism-like domains connected by an linker subdomain of less regular structure
  4. 383622Superfamily b.144.1: Trimeric adhesin [101999] (1 family) (S)
  5. 383623Family b.144.1.1: Trimeric adhesin [102000] (1 protein)
  6. 383624Protein Autotransporter Hia [102001] (1 species)
  7. 383625Species Haemophilus influenzae [TaxId:727] [102002] (1 PDB entry)
  8. 383627Domain d1s7mb_: 1s7m B: [98650]

Details for d1s7mb_

PDB Entry: 1s7m (more details), 2.1 Å

PDB Description: Crystal Structure of HiaBD1

SCOP Domain Sequences for d1s7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7mb_ b.144.1.1 (B:) Autotransporter Hia {Haemophilus influenzae}
akteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplts
sadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggste
yhdqvrnanevkfksgnginvsgktvngrreitfela

SCOP Domain Coordinates for d1s7mb_:

Click to download the PDB-style file with coordinates for d1s7mb_.
(The format of our PDB-style files is described here.)

Timeline for d1s7mb_: