Lineage for d1s7ma_ (1s7m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824930Fold b.144: Trimeric adhesin [101998] (1 superfamily)
    trimer; contains two different beta-prism-like domains connected by an linker subdomain of less regular structure
  4. 2824931Superfamily b.144.1: Trimeric adhesin [101999] (1 family) (S)
  5. 2824932Family b.144.1.1: Trimeric adhesin [102000] (1 protein)
  6. 2824933Protein Autotransporter Hia [102001] (1 species)
  7. 2824934Species Haemophilus influenzae [TaxId:727] [102002] (1 PDB entry)
  8. 2824935Domain d1s7ma_: 1s7m A: [98649]

Details for d1s7ma_

PDB Entry: 1s7m (more details), 2.1 Å

PDB Description: Crystal Structure of HiaBD1
PDB Compounds: (A:) Hia

SCOPe Domain Sequences for d1s7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ma_ b.144.1.1 (A:) Autotransporter Hia {Haemophilus influenzae [TaxId: 727]}
gakteinkdgltitpangagannantisvtkdgisaggqsvknvvsglkkfgdanfdplt
ssadnltkqnddaykgltnldekgtdkqtpvvadntaatvgdlrglgwvisadkttggst
eyhdqvrnanevkfksgnginvsgktvngrreitfela

SCOPe Domain Coordinates for d1s7ma_:

Click to download the PDB-style file with coordinates for d1s7ma_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ma_: