SCOP 1.71: Domain d1s7jb_: 1s7j B:

Lineage for d1s7jb_ (1s7j B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam 02567

6. Protein Hypothetical protein EF0119 [102852] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry)

8. Domain d1s7jb_: 1s7j B: [98648]
   structural genomics

Details for d1s7jb_

PDB Entry: 1s7j, 2.3 Å

PDB Description: crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)

SCOP Domain Sequences for d1s7jb_:

Sequence; same for both SEQRES and ATOM records:

>d1s7jb_ d.21.1.2 (B:) Hypothetical protein EF0119 {Enterococcus faecalis}
msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
enrviiggtaklfakgeayl

Timeline for d1s7jb_:

• d1s7jb_ first appeared in SCOP 1.67
  
• d1s7jb_ appears in SCOP 1.69
  
• d1s7jb_ appears in SCOP 1.73
  
• d1s7jb_ appears in the current release, SCOPe 2.08