Lineage for d1s7jb_ (1s7j B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600808Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 600809Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 600817Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam 02567
  6. 600818Protein Hypothetical protein EF0119 [102852] (1 species)
  7. 600819Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry)
  8. 600821Domain d1s7jb_: 1s7j B: [98648]
    structural genomics

Details for d1s7jb_

PDB Entry: 1s7j (more details), 2.3 Å

PDB Description: crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)

SCOP Domain Sequences for d1s7jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7jb_ d.21.1.2 (B:) Hypothetical protein EF0119 {Enterococcus faecalis}
msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
enrviiggtaklfakgeayl

SCOP Domain Coordinates for d1s7jb_:

Click to download the PDB-style file with coordinates for d1s7jb_.
(The format of our PDB-style files is described here.)

Timeline for d1s7jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s7ja_