Lineage for d1s7ja_ (1s7j A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501666Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 501667Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 501675Family d.21.1.2: PhzC/PhzF-like [89863] (3 proteins)
  6. 501676Protein Hypothetical protein EF0119 [102852] (1 species)
  7. 501677Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry)
  8. 501678Domain d1s7ja_: 1s7j A: [98647]

Details for d1s7ja_

PDB Entry: 1s7j (more details), 2.3 Å

PDB Description: crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)

SCOP Domain Sequences for d1s7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis}
msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr
wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp
eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas
gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk
enrviiggtaklfakgeayl

SCOP Domain Coordinates for d1s7ja_:

Click to download the PDB-style file with coordinates for d1s7ja_.
(The format of our PDB-style files is described here.)

Timeline for d1s7ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s7jb_