![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.2: PhzC/PhzF-like [89863] (3 proteins) |
![]() | Protein Hypothetical protein EF0119 [102852] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [102853] (1 PDB entry) |
![]() | Domain d1s7ja_: 1s7j A: [98647] |
PDB Entry: 1s7j (more details), 2.3 Å
SCOP Domain Sequences for d1s7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ja_ d.21.1.2 (A:) Hypothetical protein EF0119 {Enterococcus faecalis} msypyyivdafaeevfkgnpaavyvlekwlpeavmqniaiennlsetaftvkegqsyalr wftpereidlcghatlatafvlfnyysvaeetlhftsqsgplavtkkeeyyyldfpyilp eripilpeyeaalgtkiyeaylgrdlffvlkdeetvakitpdfsalkaldlgvgvivtas gdsvdfvsrtffpklrinedpvcgsahanlipywgkrlnqttlsayqvsprggfltcevk enrviiggtaklfakgeayl
Timeline for d1s7ja_: