Lineage for d1s7gc_ (1s7g C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828587Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 828588Protein AF0112, Sir2 homolog (Sir2-AF2) [82380] (1 species)
  7. 828589Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [82381] (3 PDB entries)
  8. 828593Domain d1s7gc_: 1s7g C: [98644]

Details for d1s7gc_

PDB Entry: 1s7g (more details), 2.3 Å

PDB Description: Structural Basis for the Mechanism and Regulation of Sir2 Enzymes
PDB Compounds: (C:) NAD-dependent deacetylase 2

SCOP Domain Sequences for d1s7gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7gc_ c.31.1.5 (C:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
kiveevkrlrse

SCOP Domain Coordinates for d1s7gc_:

Click to download the PDB-style file with coordinates for d1s7gc_.
(The format of our PDB-style files is described here.)

Timeline for d1s7gc_: