Lineage for d1s78d2 (1s78 D:114-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027002Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2027291Domain d1s78d2: 1s78 D:114-216 [98627]
    Other proteins in same PDB: d1s78a1, d1s78a2, d1s78a3, d1s78a4, d1s78b1, d1s78b2, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78e1, d1s78e2, d1s78f1
    part of anti-ERBb2 Fab Pertuzumab
    complexed with nag

Details for d1s78d2

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex
PDB Compounds: (D:) Pertuzumab Fab heavy chain

SCOPe Domain Sequences for d1s78d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s78d2 b.1.1.2 (D:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1s78d2:

Click to download the PDB-style file with coordinates for d1s78d2.
(The format of our PDB-style files is described here.)

Timeline for d1s78d2: