Lineage for d1s78b3 (1s78 B:166-322)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427814Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 427815Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins)
  6. 427832Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 427833Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries)
  8. 427838Domain d1s78b3: 1s78 B:166-322 [98622]
    Other proteins in same PDB: d1s78a1, d1s78a2, d1s78b1, d1s78b2, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2

Details for d1s78b3

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex

SCOP Domain Sequences for d1s78b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s78b3 g.3.9.1 (B:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

SCOP Domain Coordinates for d1s78b3:

Click to download the PDB-style file with coordinates for d1s78b3.
(The format of our PDB-style files is described here.)

Timeline for d1s78b3: