Lineage for d1s78a4 (1s78 A:489-564)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961098Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1961099Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1961130Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 1961131Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries)
  8. 1961135Domain d1s78a4: 1s78 A:489-564 [98619]
    Other proteins in same PDB: d1s78a1, d1s78a2, d1s78b1, d1s78b2, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2
    complexed with nag

Details for d1s78a4

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex
PDB Compounds: (A:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1s78a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
chqlcarghcwgpgptqcvncsqflrgqecveecrvlqglpreyvnarhclpchpecqpq
ngsvtcfgpeadqcva

SCOPe Domain Coordinates for d1s78a4:

Click to download the PDB-style file with coordinates for d1s78a4.
(The format of our PDB-style files is described here.)

Timeline for d1s78a4: