Lineage for d1s6vc_ (1s6v C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719985Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2719986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. 2720080Domain d1s6vc_: 1s6v C: [98611]
    Other proteins in same PDB: d1s6vb_, d1s6vd_
    complexed with hec, iod

Details for d1s6vc_

PDB Entry: 1s6v (more details), 1.88 Å

PDB Description: structure of a cytochrome c peroxidase-cytochrome c site specific cross-link
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d1s6vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6vc_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwragrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaanncftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1s6vc_:

Click to download the PDB-style file with coordinates for d1s6vc_.
(The format of our PDB-style files is described here.)

Timeline for d1s6vc_: