| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mitochondrial cytochrome c [46642] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries) Uniprot P00044 |
| Domain d1s6vb_: 1s6v B: [98610] Other proteins in same PDB: d1s6va_, d1s6vc_ complexed with hem, iod |
PDB Entry: 1s6v (more details), 1.88 Å
SCOPe Domain Sequences for d1s6vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s6vb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate
Timeline for d1s6vb_: