Lineage for d1s6vb_ (1s6v B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 350826Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 350977Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 350978Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (34 PDB entries)
  8. 350982Domain d1s6vb_: 1s6v B: [98610]
    Other proteins in same PDB: d1s6va_, d1s6vc_

Details for d1s6vb_

PDB Entry: 1s6v (more details), 1.88 Å

PDB Description: structure of a cytochrome c peroxidase-cytochrome c site specific cross-link

SCOP Domain Sequences for d1s6vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6vb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmcfgglkkekdrndlitylkkate

SCOP Domain Coordinates for d1s6vb_:

Click to download the PDB-style file with coordinates for d1s6vb_.
(The format of our PDB-style files is described here.)

Timeline for d1s6vb_: